Protein Info for Sama_1021 in Shewanella amazonensis SB2B

Annotation: thiamine-phosphate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR01379: thiamine-phosphate kinase" amino acids 16 to 333 (318 residues), 359 bits, see alignment E=9.5e-112 PF00586: AIRS" amino acids 40 to 151 (112 residues), 110.3 bits, see alignment E=7.2e-36 PF02769: AIRS_C" amino acids 163 to 318 (156 residues), 45 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 59% identical to THIL_ECOLI: Thiamine-monophosphate kinase (thiL) from Escherichia coli (strain K12)

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 100% identity to saz:Sama_1021)

MetaCyc: 59% identical to thiamine monophosphate kinase (Escherichia coli K-12 substr. MG1655)
Thiamine-phosphate kinase. [EC: 2.7.4.16]

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4C2 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Sama_1021 thiamine-phosphate kinase (RefSeq) (Shewanella amazonensis SB2B)
MGRRADIKADAGMTVKEFQLIDQYFCGRGPVRRDVKHGIGDDCALVQPAEHKQIAISCDT
LIEGVHFFNDMPAWALGYKALAVNLSDLAAMGAEPAWFTLGLSLPSVDESWLAAFSEGLF
EAAEYYGIALIGGDTTQSPVKVIAVTINGQVPEGKALTRYGARSGDWIYVTGSLGDSALG
LDILRGRQQSRPEHSEYLIERHYRPTPRVLAGQSLRGLASSAIDLSDGLMSDLGHVLKAS
NVGAYIDVEKLPLSQAMKDSVPLEQALGYALTGGEDYELLFTVPEAQRGALEIALANAGV
KFFRIGQITAGSTLKLTHNGEPFTPMNKGFEHF