Protein Info for Sama_0998 in Shewanella amazonensis SB2B

Annotation: U32 family peptidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01136: Peptidase_U32
  • amino acids 76 to 332 (257 residues), 220.7 bits, E=8.7e-70

Best Hits

Swiss-Prot: 60% identical to YHBU_ECOLI: Uncharacterized protease YhbU (yhbU) from Escherichia coli (strain K12)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 100% identity to saz:Sama_0998)

Predicted SEED Role

"Putative protease"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

See A1S499 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Sama_0998 U32 family peptidase (RefSeq) (Shewanella amazonensis SB2B)
MELLCPAGNLAALKVALNAGADAIYLGLKDDTNARSFAGLNFTPEQMTEARRLTAAAGKK
LYLTLNTFPKPGEEQRWYQAVDLAARLKADALIVADISLLDYAHSRYPNLPLHLSVQASA
TNLGALTLYKEAFNIERVVLPRVLSMKQVRDLAADTPVDLEVFAFGSLCIMAEGRCHLSS
YVTGQSPNTGGSCSPAKHVRWQQQGDQSLTRLNEVLIDKASQHEQMGYPVVCKGRFIAED
SDTPDYLLESPTSLNTLSLLPELARAGVVSLKIEGRQRSPAYVEQVTRVWRAAIDTFKRN
PEQYQVQADWDRALGKLSEGQITTLGAYERRWQ