Protein Info for Sama_0991 in Shewanella amazonensis SB2B

Annotation: acyltransferase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 PF19576: Acyltransf_2" amino acids 30 to 263 (234 residues), 87 bits, see alignment E=1.7e-28 PF01553: Acyltransferase" amino acids 72 to 194 (123 residues), 28.3 bits, see alignment E=2.2e-10 PF13444: Acetyltransf_5" amino acids 325 to 425 (101 residues), 93.7 bits, see alignment E=1.5e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0991)

Predicted SEED Role

"Putative hemolysin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S492 at UniProt or InterPro

Protein Sequence (586 amino acids)

>Sama_0991 acyltransferase family protein (RefSeq) (Shewanella amazonensis SB2B)
MIFTVDNLIDTRLPAISASPWLKRPVSAALRFLLHEEECNRIAAEFAFMQGVDFAGAVLE
TLNFSFTVPDSDLDNIPAKGRVVIFANHPIGSLDALAMIKLIGEIRPDIKVVANEILMAI
EPLHPILLPVRNMGGGTPKHHLEAIHRHLQNDGALLIFPAGEVSRLRPNGVRDTLWQSGF
LKIALACDAPLLPLFADARNSATFYGTSMIYKPLSTLLLVKEMFRQKQRTMPIRIGELIA
LDALKAKDFDLKTKVTLLKNHLYRIGKNRPPLFKTQSPIARPECRAELKAALGACEHLGN
TQDGKTIYLYQHQGSNPIMREIGRLREQAFRAVGEGTGKRRDIDAFDSHYLHLVLWDKEA
LEVVGAYRFASASKLHQELGANSLYSQSLFDFTDAFAPCFAEGLELGRSFVQPRYWGKRS
LDYLWFGIGAFLARNPQYRYLFGPVSISGQLPLAAREMLVDFYGRFYGANTQLASPKQAF
RLSDERRRELDKLYEGLPMEDAFKRLKHTLSGMGVAVPTLYKQYTELCHEDGVSFAAFSV
DPDFGHCVDGLVTVDLTRLKDKKRERYLGVHRQDNAQLVLADGEGV