Protein Info for Sama_0983 in Shewanella amazonensis SB2B

Annotation: DNA-binding transcriptional regulator TorR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 102.9 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 42% identical to OMPR_ECO57: Transcriptional regulatory protein OmpR (ompR) from Escherichia coli O157:H7

KEGG orthology group: K07772, two-component system, OmpR family, torCAD operon response regulator TorR (inferred from 100% identity to saz:Sama_0983)

Predicted SEED Role

"TorCAD operon transcriptional regulatory protein TorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S484 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Sama_0983 DNA-binding transcriptional regulator TorR (RefSeq) (Shewanella amazonensis SB2B)
MAYTVLVVDDEAVIRTRLKGYFSKEGYRVLEAANGEEMWQQLALAHVDLIMLDINLPGTD
GLSLTRELRSRSDVGIILVSGRDETVDRIVGLEMGADDYVTKPFELRELLVRVKNLLWRI
SLVEKAKQQAVAAMDEGDDRIEFDDYVLELGSRKLSRGEAVIKLTKAEFELLVAFALHPR
QVLSRERLMQQTSHRSEDANDRTIDVIIRRLRGKLNPELFVTVHGEGYLFAASVRD