Protein Info for Sama_0968 in Shewanella amazonensis SB2B

Name: prfC
Annotation: peptide chain release factor 3 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 TIGR00503: peptide chain release factor 3" amino acids 4 to 528 (525 residues), 1007.7 bits, see alignment E=9.4e-308 PF00009: GTP_EFTU" amino acids 12 to 276 (265 residues), 162.5 bits, see alignment E=2.7e-51 TIGR00231: small GTP-binding protein domain" amino acids 16 to 172 (157 residues), 72.5 bits, see alignment E=3.6e-24 PF01926: MMR_HSR1" amino acids 16 to 142 (127 residues), 22.1 bits, see alignment E=4.2e-08 PF22042: EF-G_D2" amino acids 294 to 380 (87 residues), 87.3 bits, see alignment E=1.8e-28 PF03144: GTP_EFTU_D2" amino acids 313 to 379 (67 residues), 41.9 bits, see alignment E=3.5e-14 PF16658: RF3_C" amino acids 386 to 512 (127 residues), 154 bits, see alignment E=6.1e-49 PF14492: EFG_III" amino acids 396 to 462 (67 residues), 27.9 bits, see alignment E=6.2e-10

Best Hits

Swiss-Prot: 87% identical to RF3_VIBVU: Peptide chain release factor 3 (prfC) from Vibrio vulnificus (strain CMCP6)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 100% identity to saz:Sama_0968)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S469 at UniProt or InterPro

Protein Sequence (528 amino acids)

>Sama_0968 peptide chain release factor 3 (RefSeq) (Shewanella amazonensis SB2B)
MSNTLLAEVASRRTFAIISHPDAGKTTITEKVLLHGRAIQSAGTVKGRGSGQHAKSDWME
MEKERGISVTTSVMQFPYNSCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGVED
RTRKLMEVTRLRDTPIVTFMNKLDRDIRDPMELLDEVETELNILCAPITWPIGCGKLFKG
VYHLHRDETILYQTGHGHTIQELRIVKGLDNPDLDAAVGSDFAEQLREELELVRGASNEF
DKELFLSGELTPVYFGTALGNFGVDHMLDGLTEWAPAPMPRETSERTVEAGEDKFSGFVF
KIQANMDPKHRDRIAFMRIVSGKYTQGMKMKHVRIGKTVNISDAVTFMAGDRERAEEAFA
GDIIGLHNHGTIQIGDTFTQGEDLKFTGIPNFAPEMFRRIRLKDPLKQKQLLKGLVQLSE
EGAVQVFRPLDTNDLIVGAVGVLQFEVVVARLKSEYNVEAIYEAVNVATARWVYCEDGRK
LEEFKRKCSTNLALDGGDNLTYIAPTMVNLNLSMERYPDIQFAKTREH