Protein Info for Sama_0957 in Shewanella amazonensis SB2B

Annotation: Triose-phosphate isomerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00121: TIM" amino acids 6 to 256 (251 residues), 309.3 bits, see alignment E=9.6e-97 TIGR00419: triose-phosphate isomerase" amino acids 7 to 246 (240 residues), 217.4 bits, see alignment E=1.1e-68

Best Hits

Swiss-Prot: 100% identical to TPIS_SHEAM: Triosephosphate isomerase (tpiA) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 100% identity to saz:Sama_0957)

MetaCyc: 49% identical to triose-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S458 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Sama_0957 Triose-phosphate isomerase (RefSeq) (Shewanella amazonensis SB2B)
MALRRPMVAGNWKMNGSAALAQELFKKFAVKLQNDSAEVVLCPPTIYLESVRQLLEANKE
ALNGCLVRMGAQNLSQHDFGAYTGEISGQMLKDSGCRYVIVGHSERRRMYGETSDIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRRRLSEVSPFIGENVRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSTEFLTLCSIAMSA