Protein Info for Sama_0954 in Shewanella amazonensis SB2B

Annotation: vesicle-fusing ATPase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 103 to 124 (22 residues), see Phobius details PF06480: FtsH_ext" amino acids 8 to 96 (89 residues), 52.1 bits, see alignment E=2e-17 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 104 to 598 (495 residues), 815.3 bits, see alignment E=9.7e-250 PF06068: TIP49" amino acids 178 to 226 (49 residues), 23.9 bits, see alignment 6.8e-09 PF07728: AAA_5" amino acids 192 to 313 (122 residues), 25.6 bits, see alignment E=3.4e-09 PF00004: AAA" amino acids 193 to 325 (133 residues), 159.8 bits, see alignment E=1.5e-50 PF17862: AAA_lid_3" amino acids 352 to 391 (40 residues), 45.8 bits, see alignment 1.1e-15 PF01434: Peptidase_M41" amino acids 406 to 597 (192 residues), 243.4 bits, see alignment E=5.3e-76

Best Hits

Swiss-Prot: 78% identical to FTSH_ECOLI: ATP-dependent zinc metalloprotease FtsH (ftsH) from Escherichia coli (strain K12)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 100% identity to saz:Sama_0954)

MetaCyc: 78% identical to ATP-dependent zinc metalloprotease FtsH (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S455 at UniProt or InterPro

Protein Sequence (650 amino acids)

>Sama_0954 vesicle-fusing ATPase (RefSeq) (Shewanella amazonensis SB2B)
MSDMAKNLILWVVIAVVLMSVFQGYSPSSSSSQKMEYSTFLEENKADQILSVEFKSDQRT
IEGQKRSGEKFTTIMPMYDQDLINDLVRKGVVIKGEEAQESSFLTQIFISWFPMLLLIGV
WIFFMRQMQGGGGKGAMSFGKSKAKLMSEDQIKTTFADVAGCDEAKEEVKEMVDYLRDPT
KFQKLGGRIPTGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRD
MFDQAKKSAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIA
ATNRPDVLDAALLRPGRFDRQVVVGLPDVRGREQILKVHMRKVPLAEDVKASVIARGTPG
FSGADLANLVNEAALFAARGNRRVVSMEEFERAKDKIMMGAERRSMVMSEAEKEMTAYHE
AGHAIVGYLVPEHDPVHKVTIIPRGRALGVTFFLPEADAISQSRRKLESKISVAYGGRLA
EELIYGTEQVSTGASQDIKYATSIARNMVTQWGFSEKLGPLLYADEEGEVFLGRSMAKAK
HMSDETAALIDAEVKVIIDRNYERANQLLVENMDILHAMKDALMKYETIDSRQIEDLMER
REVRLPADWQKDEQNGDKGDKGNKGVEAAAQDNEPAEPTDLNPDEPVIKH