Protein Info for Sama_0949 in Shewanella amazonensis SB2B

Annotation: cytochrome b561 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 176 (168 residues), 103.5 bits, see alignment E=6.2e-34

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 100% identity to saz:Sama_0949)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S450 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Sama_0949 cytochrome b561 (RefSeq) (Shewanella amazonensis SB2B)
MWRNRASGYGWIAIGIHWMMAVLILGLFALGLWMVELNYYSQWYQVAPYWHKGLGGVVFA
LLLLRLGIRLGDQQPSALGKGAEVVLAKIVHLALYLLPLGLVISGYLISTADGRALELLG
LVSIPSLVSFPGQEDTAGQIHGVLAWLLIALVSAHALAAIKHHLINRNATLLRMLRPQKE
I