Protein Info for Sama_0947 in Shewanella amazonensis SB2B

Updated annotation (from data): transmembrane glucosamine N-acetyltransferase NagX
Rationale: Specifically important for glucosamine utilization. NagX proteins are distantly related to human HGSNAT (uniprot:Q68CP4), which is a transmembrane acetyl-CoA:alpha-glucosaminide N-acetyltransferase.
Original annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0947)

MetaCyc: 72% identical to D-glucosamine N-acetyltransferase (Shewanella sp. ANA-3)
Glucosamine N-acetyltransferase. [EC: 2.3.1.3]

Predicted SEED Role

"N-acetylglucosamine related transporter, NagX" in subsystem Chitin and N-acetylglucosamine utilization

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S448 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Sama_0947 transmembrane glucosamine N-acetyltransferase NagX (Shewanella amazonensis SB2B)
MQATQTKAAKPRLMSLDALRGFDMFWILGGEKLFIALFALTGWSFWQLADAEMHHSEWHG
FTFYDLIFPLFIFLSGVALGLSPKRLDKLAPAERNPIYRHAVKRLFLLLALGVLYNHGWG
TGIPAHSDEVRYASVLGRIAFAWFFAALLVWHTSLRTQIATALAILFGYAAIQLWLPVPG
GQAGVLTPSGSINAWVDTHFLPGITYQHRPYDPEGILSTLPAIVNALMGVFVGRFIVKPD
ARGDWAKAGILTGAGGLSLVLGWSLDSVLPVNKDLWTSSFVLVTTGWNLLFLALFYVLVD
VLGAKRLAFPFVVIGVNSIIIYLASSLMNWEYLSKSLFGGVIHALPMPAQALAAAIGFLL
VQWALLYWMYRKGIFIRI