Protein Info for Sama_0942 in Shewanella amazonensis SB2B

Annotation: putative methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details PF00672: HAMP" amino acids 164 to 214 (51 residues), 51.5 bits, see alignment 1e-17 PF00015: MCPsignal" amino acids 312 to 461 (150 residues), 140.6 bits, see alignment E=4.7e-45

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to saz:Sama_0942)

Predicted SEED Role

"N-acetylglucosamine regulated methyl-accepting chemotaxis protein" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S443 at UniProt or InterPro

Protein Sequence (495 amino acids)

>Sama_0942 putative methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella amazonensis SB2B)
MNNNLALKVQIGLALALSGLMVLLFGATFLFEKQKLEQAFAEYEKDTLASLAVTMAQPVF
TYDFEQIEAILSVTLEQEQIAALKVFDHRGKPMASVGSNTGEDAGLEQKSISFSDNGKPT
GKMEVTFTRAPIEARLSSLLLGLLAQGALILLLSMVVIVIILKKLVITPLAHVVSAMEDV
ASGDGDLTRRLPVESQDEIGRLASAFNAFIEQIHATVTKVQETAAQLIEGAGTLGSLSGA
NNLRVQEQRQETEAAVTAVSQLSASAAEVAGNALRTSEAAAEADAQVDESQRRFDQSLGL
TRQLVDELSRCAISVQQLQQETQKIDEVVVVINSIAEQTNLLALNAAIEAARAGEQGRGF
AVVADEVRTLASRTQQATGEIQKMIQQVQTRVNDTVTVMGASQQLSDKSLSQAEEIKSML
ASVTRLVSNINAMNTEVAHAASEQTSVTENISRSLNDLAGISGSASADSASLAQSGERLF
QQGERLRALVNSFRL