Protein Info for Sama_0937 in Shewanella amazonensis SB2B

Annotation: LacI family transcription regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00356: LacI" amino acids 4 to 49 (46 residues), 64.2 bits, see alignment 1.5e-21 PF00532: Peripla_BP_1" amino acids 62 to 295 (234 residues), 83.2 bits, see alignment E=4.8e-27 PF13407: Peripla_BP_4" amino acids 63 to 310 (248 residues), 36.6 bits, see alignment E=7.8e-13 PF13377: Peripla_BP_3" amino acids 174 to 333 (160 residues), 114.7 bits, see alignment E=1e-36

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to saz:Sama_0937)

Predicted SEED Role

"Transcriptional regulator of N-acetylglucosamine utilization, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S438 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Sama_0937 LacI family transcription regulator (RefSeq) (Shewanella amazonensis SB2B)
MKVTINDVAKYAGVSIKTVSRVTNNEPSVKQATIDKVNEAIKALNYQPNLAARNLAGTKS
YVIGFIYDNPNAYYIIDMQNGILSACRDKGYELLIHPCDATADSICEELTALVKHARLAG
LVLTPPLSEDPKILAALDSIEAHYVRIIAGDKTKESCGLTVLVNDRHGAVSITQHLIDLG
HKHIAFISGDEQHESTKERFAGFCDALSLNNITLNPAFVIEGQYSFESGVEGAKQLLSMT
PRPTAIVACNDEIAAGALFAARLQGVDIPRDISIVGFEDSPFSRQTWPKLTTVHQPNQKI
AQVATELLIANRKEQRLDSAKVFTPEPVVRDSSSNPG