Protein Info for Sama_0934 in Shewanella amazonensis SB2B

Annotation: type IV pilus biogenesis protein, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details PF07963: N_methyl" amino acids 1 to 25 (25 residues), 33 bits, see alignment 3e-12 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 5 to 27 (23 residues), 31.8 bits, see alignment (E = 4.3e-12) PF12019: GspH" amino acids 46 to 156 (111 residues), 74 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: K08084, type IV fimbrial biogenesis protein FimT (inferred from 100% identity to saz:Sama_0934)

Predicted SEED Role

"Type IV fimbrial biogenesis protein FimT" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S435 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Sama_0934 type IV pilus biogenesis protein, putative (RefSeq) (Shewanella amazonensis SB2B)
MKHPHGFTLIELMITIAIATILLSIGLPQLTELHQANRADSAIKVIQQTLQYARNTAISY
GLRVTVCPLKDNQCTNDWHQGLTVFTDSGVSNQLDGNDILLMQTGSFDSNDFMFYNRSAA
RFLPDGLASGSNGTFKYCPGSADSPYSKAVIINQAGRVRFSTDKNINCTQ