Protein Info for Sama_0892 in Shewanella amazonensis SB2B

Name: rplS
Annotation: 50S ribosomal protein L19 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 TIGR01024: ribosomal protein bL19" amino acids 3 to 113 (111 residues), 170.9 bits, see alignment E=4.4e-55 PF01245: Ribosomal_L19" amino acids 3 to 113 (111 residues), 171 bits, see alignment E=3.6e-55

Best Hits

Swiss-Prot: 100% identical to RL19_SHEAM: 50S ribosomal protein L19 (rplS) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K02884, large subunit ribosomal protein L19 (inferred from 100% identity to saz:Sama_0892)

MetaCyc: 78% identical to 50S ribosomal subunit protein L19 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L19p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3Z3 at UniProt or InterPro

Protein Sequence (117 amino acids)

>Sama_0892 50S ribosomal protein L19 (RefSeq) (Shewanella amazonensis SB2B)
MNNIIKMLNDEQMKKDVPDFGPGDTVVVQVRVKEGDKERLQAFEGVVIAKRNRGLHSAFT
VRKISNGEGVERAFQTHSPLISSIEVKRRGRVRRAKLYYLRERSGKSARIREKLATK