Protein Info for Sama_0880 in Shewanella amazonensis SB2B

Name: rnc
Annotation: ribonuclease III (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 TIGR02191: ribonuclease III" amino acids 12 to 223 (212 residues), 244.3 bits, see alignment E=5.2e-77 PF14622: Ribonucleas_3_3" amino acids 20 to 138 (119 residues), 121.7 bits, see alignment E=3.4e-39 PF00636: Ribonuclease_3" amino acids 39 to 128 (90 residues), 89.1 bits, see alignment E=4.4e-29 PF00035: dsrm" amino acids 157 to 224 (68 residues), 52.2 bits, see alignment E=1.1e-17

Best Hits

Swiss-Prot: 100% identical to RNC_SHEAM: Ribonuclease 3 (rnc) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to saz:Sama_0880)

MetaCyc: 67% identical to RNase III (Escherichia coli K-12 substr. MG1655)
Ribonuclease III. [EC: 3.1.26.3]

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3Y1 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Sama_0880 ribonuclease III (RefSeq) (Shewanella amazonensis SB2B)
MEPIKNLPRLCRTLGYEFSDIRLLEQALTHRSASNQHNERLEFLGDSILSIVISDALFHQ
FPKATEGDLSRMRATLVRGDTLAVIAKEFKLGDYLNLGPGELKSGGFRRESILADAVEAI
IGAVYLDADLETCRSLLLGWYETRLADIKPGVGQKDAKTLLQEYLQGMKKPLPEYQVTQV
EGEAHDQTFTVECRVTDLADAVVGVGSSRRKAEQMAAAQVLELLNQ