Protein Info for Sama_0875 in Shewanella amazonensis SB2B

Annotation: sigma-E factor negative regulatory protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 96 to 114 (19 residues), see Phobius details PF03872: RseA_N" amino acids 6 to 86 (81 residues), 91.9 bits, see alignment E=3.1e-30 PF03873: RseA_C" amino acids 124 to 179 (56 residues), 77.5 bits, see alignment E=7.4e-26

Best Hits

Swiss-Prot: 41% identical to RSEA_SALT1: Anti-sigma-E factor RseA (rseA) from Salmonella typhimurium (strain 14028s / SGSC 2262)

KEGG orthology group: K03597, sigma-E factor negative regulatory protein RseA (inferred from 100% identity to saz:Sama_0875)

Predicted SEED Role

"Sigma factor RpoE negative regulatory protein RseA" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3X6 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Sama_0875 sigma-E factor negative regulatory protein (RefSeq) (Shewanella amazonensis SB2B)
MEKTGQEWVSASVDGETDRQTLAELAADTDSHAKWQRYHLMGDAMRDELPQAMPLDLSAR
IAAALEDEPTILAPKVEREATQAPSRAVVVPFMRQLGQYGIAAAVALMAVVGVQNYQSTQ
DDAPLPVLNTRPLVGTATPVSLQTGPVANQNQGNANDQLLEQRRRINAYLQDHMLQQRLN
TGAVVDDNSEVTPIPVNR