Protein Info for Sama_0873 in Shewanella amazonensis SB2B

Annotation: L-aspartate oxidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 TIGR00551: L-aspartate oxidase" amino acids 7 to 520 (514 residues), 678.9 bits, see alignment E=2e-208 PF00890: FAD_binding_2" amino acids 10 to 392 (383 residues), 335.8 bits, see alignment E=9.2e-104 PF01266: DAO" amino acids 10 to 72 (63 residues), 28.8 bits, see alignment E=1.8e-10 PF02910: Succ_DH_flav_C" amino acids 441 to 524 (84 residues), 56.6 bits, see alignment E=5.4e-19

Best Hits

Swiss-Prot: 77% identical to NADB_VIBCH: L-aspartate oxidase (nadB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 100% identity to saz:Sama_0873)

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3X4 at UniProt or InterPro

Protein Sequence (535 amino acids)

>Sama_0873 L-aspartate oxidase (RefSeq) (Shewanella amazonensis SB2B)
MKQAVEHQSDILVIGSGAAGLTLALHLAEKAKVILISKGPLSEGSTLYAQGGIASVFDEG
DTIESHVEDTLVAGAGICDETVVTYTAANAKAAMQWLISCGVPFDKEEHITNEAQPYHLT
REGGHSHRRILHAADATGKAVQTTLQELAANHPNIQVLERYNAIDLITTRKLGRTGNRVL
GAYVWNRSQEQVETVKARFVALATGGSSKVYQYTSNPDVASGDGIAMAWRAGCRVANMEF
NQFHPTCLYHAEARNFLLTEALRGEGAYLRRPDGSRFMPDFDERAELAPRDIVARAIDYE
MKRLGVDCMYLDISHKPADFIIKHFPTIHSRCLELGLDITKEPIPIVPAAHYTCGGVMTD
LHGQTDLNGLYAIGEVAYTGLHGANRLASNSLLECLVFARAAAQDIESLMGKIAMPGQLP
AWDESRVSNSDEEVVIAHNWHELRLFMWDYVGIVRTDKRLERALRRVTMLQQEIQEYYSN
FRVSNNLLELRNLVQVAELIIRCAMARKESRGLHCNLDHPEKLDVSGPTILTPER