Protein Info for Sama_0862 in Shewanella amazonensis SB2B

Annotation: DNA mismatch repair protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 20 to 20 (1 residues), see Phobius details transmembrane" amino acids 21 to 35 (15 residues), see Phobius details TIGR02248: DNA mismatch repair endonuclease MutH" amino acids 6 to 221 (216 residues), 334.5 bits, see alignment E=9.6e-105 PF02976: MutH" amino acids 55 to 153 (99 residues), 125.3 bits, see alignment E=4.2e-41

Best Hits

Swiss-Prot: 100% identical to MUTH_SHEAM: DNA mismatch repair protein MutH (mutH) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03573, DNA mismatch repair protein MutH (inferred from 100% identity to saz:Sama_0862)

MetaCyc: 60% identical to DNA mismatch repair protein MutH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair endonuclease MutH" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3W3 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Sama_0862 DNA mismatch repair protein (RefSeq) (Shewanella amazonensis SB2B)
MNTPLPPQSLDELLRRAKMMAGLSLGQLAAGLGWPVPANLKRDKGWIGQLIEQELGATAG
SRPEQDFLHLGVELKTIPIDRSGKPLETTYVCVAPLMDTHGLRWEQSLVKHKLERVLWVP
VEGERDIPVADRRIGTAILWQPTPQQSASLRQDWEEIMEFIALGKVHRLSARHGEVLQLR
PKAANAAAKTECIMEDGTVGLTNPRGFYLKIPFTQAILRQAFDY