Protein Info for Sama_0848 in Shewanella amazonensis SB2B

Name: anmK
Annotation: anhydro-N-acetylmuramic acid kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03702: AnmK" amino acids 5 to 368 (364 residues), 490.9 bits, see alignment E=1.3e-151

Best Hits

Swiss-Prot: 100% identical to ANMK_SHEAM: Anhydro-N-acetylmuramic acid kinase (anmK) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 100% identity to saz:Sama_0848)

MetaCyc: 51% identical to anhydro-N-acetylmuramic acid kinase (Escherichia coli K-12 substr. MG1655)
RXN0-4621 [EC: 2.7.1.170]

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3U9 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Sama_0848 anhydro-N-acetylmuramic acid kinase (RefSeq) (Shewanella amazonensis SB2B)
MSQSLFIGLMSGTSMDGVDAVLVDFDTPSPKLIATHTEAIPEHLFKGLQRLCQPGQDEVN
RLGRLDRSVGSLFAKAVNNLLASSGIDKSQVVAIGSHGQTVRHMPNLEVGFTVQIGDPNT
IAAETGIDVIADFRRKDIALGGQGAPLVPAFHQQIFAKADKRRVILNIGGIANITWLPGN
AEAVLGFDTGPGNTLIDGWIQQVKQQAFDRDGAFAASGKTDNTLLAQLLSHPYFMQPYPK
STGRELFNNAWLEQQLEKFGHLDEADIQSTLLDLTCHSIAADILKLSNSGELFVCGGGAL
NIELMNRLQALLPGFTLTTTSVLGVDPKWVEAIAFAWLALRHHQGLPANLPAVTGARREA
ILGARFPAA