Protein Info for Sama_0837 in Shewanella amazonensis SB2B

Annotation: citrate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 106 to 135 (30 residues), see Phobius details amino acids 147 to 174 (28 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 389 to 414 (26 residues), see Phobius details PF03600: CitMHS" amino acids 25 to 360 (336 residues), 84.6 bits, see alignment E=3.8e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0837)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3T8 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Sama_0837 citrate transporter (RefSeq) (Shewanella amazonensis SB2B)
MLHTFLIILAILALLSIIFEEVTHLNKAKTTLFLGCISWVTLFIASGGGEHTELVAHELN
ENLLEIATLWLFLMSTMTFVAYLNAKGMIQIMVQKIFPQRVSVRMLMIQVALFALILSAF
CDNVTATLVSLGLLTTFKLDKQMRRRMAVLIIFAVNSGGVALITGDVTTLMIFLSGHVHI
SELLILFIPAAVSVFLLAILFSMNAKGEVSTTPIKRAYQPVDIAIAAIFFITIIMTMALN
VLFGIPPVLTFLTGLSVMFLVGHTIRTDKEEIKILEYIRQVEYDTLLFFLGILLLVGMLK
EIGTLELLTQVYAMHDPNISNFVTGMGSAILDNVPLTAALLKAEPVLSTPEWLGLTYAVG
VGGSLLVIGSAAGIIAMSKVKELTFVTYLKYVPSLMLSYVVGYGLTLLIAYQFYG