Protein Info for Sama_0804 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF01145: Band_7" amino acids 44 to 199 (156 residues), 60.5 bits, see alignment E=2.2e-20 PF15975: Flot" amino acids 420 to 541 (122 residues), 136.9 bits, see alignment E=3.9e-44

Best Hits

KEGG orthology group: K07192, flotillin (inferred from 100% identity to saz:Sama_0804)

Predicted SEED Role

"Inner membrane protein YqiK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3Q5 at UniProt or InterPro

Protein Sequence (585 amino acids)

>Sama_0804 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MDNSQIFTDSGTFMLMIAGVAVLGLLVIGLIFAKLYRRATKETAFVRTGFGGEKVVKDGG
AIVLPVLHETIHVNMNTLRIEVEKTQKDALITKDRMRVDVKADFYLRVAPHAEGISMAAQ
TLGTRTTRVEELKKLMESKFVDVLRAVAAEMTMTEMHEQRADFVQRVQNNVANDLEKNGL
ELESVSLTGFDQTELDFFNENNAFDAEGRARLAKIIEEKRKETNDIQQENRIKIEMRNLE
AEKESLEIKKSEEEAKLVQQQALEFKRAEQKAEIIKQREQKAREEREAEIAKERAVEAAE
IEKTREIETREIEKRKTIEQARIQQQRDIEVSEQEKQIAVAAKSEEESAARARAAEAEKL
KVEKEEAVITVRQVAEANRRKEIEVIDARKEAEREAVGVTVQAEAEKRAAEDRSSAILTE
ARAAADAKKLKAEADEKVYAVEAAGKQALYEAENVLRDEQIELQKSLAILRALPEIVANA
VKPLENIEGIKILQGYGANGATLATGEGAANGGIAEQVTQAALNYRANAPVVDAMLRELG
LVDKDKGGLNDLLTGNNALTTQAMQVVEQANVKLNGYSLGEQKAD