Protein Info for Sama_0798 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details PF06271: RDD" amino acids 12 to 149 (138 residues), 61.1 bits, see alignment E=7.6e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0798)

Predicted SEED Role

"FIG023103: Predicted transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3P9 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Sama_0798 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MINQEHANFPRAGFFRRLGAMVYDLMLAAAVWILAGVVSFALFAVLVNSGLIDRGGHEHV
IDVMNANPLYRNLNFAWILLCVAMFYVVFWSRGGQTLGMRAWRLKVQHPNGQNLSFIAAA
ARLVWSLFGLGNLFILINPDKLALQDKMTRSEVVVLSVEANQMKNWHGMQ