Protein Info for Sama_0794 in Shewanella amazonensis SB2B

Updated annotation (from data): gamma-glutamyl-gamma-aminobutyrate hydrolase (EC: 3.5.1.94)
Rationale: Specifically important for: Putrescine Dihydrochloride. Similar to puuD (PUUD_ECO57), a step in putrescine catabolism. Also, is cofit with other genes from the gamma-glutamyl-putrescine pathway. However another homolog of puuD (Sama_2645) is also important in putrescine utilization and it is not clear why. Both of the homologs in S. amazonensis have conserved active site residues (see aliignments against puuD in PaperBLAST).
Original annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 18 to 231 (214 residues), 213.6 bits, E=3.1e-67
• PF00117: GATase
  • amino acids 105 to 234 (130 residues), 53.8 bits, E=2.1e-18

Best Hits

Swiss-Prot: 40% identical to PUUD_ECO57: Gamma-glutamyl-gamma-aminobutyrate hydrolase (puuD) from Escherichia coli O157:H7

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 100% identity to saz:Sama_0794)

MetaCyc: 40% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of chorismate metabolism (50/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• superpathway of ornithine degradation (6/8 steps found)
• putrescine degradation II (3/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)
• superpathway of candicidin biosynthesis (2/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of phenylpropanoids
• Folate biosynthesis
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 3.5.1.94

Use Curated BLAST to search for 2.6.1.85 or 3.5.1.94

Sequence Analysis Tools

See A1S3P5 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Sama_0794 gamma-glutamyl-gamma-aminobutyrate hydrolase (EC: 3.5.1.94) (Shewanella amazonensis SB2B)
MPLQQESARQERKPVILMSMGQQDRNGHAYQVMTHKYMQPVVDISDCIPLLIPTCFGVAD
IEQYLDMADGVYLSGAASNIDPSLYGQENLTPEKKQDLARDLVDIALIKGAVKRGLPILG
ICRGMQEMNIAFGGDLYQKVHDEDHLNDHREDPDTPPDVQYGASHSISMVKGSWLHKLLG
DTIEVNSLHGQGIKTLGKGLEALALAEDGLVEALHAPYLPQFTLGVQWHPEWKALENPDS
IKIFKAFGEACRRRAGSALDLRIDKAS