Protein Info for Sama_0769 in Shewanella amazonensis SB2B

Annotation: UDP-N-acetylmuramate (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01225: Mur_ligase" amino acids 2 to 98 (97 residues), 80 bits, see alignment E=2.1e-26 TIGR01081: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase" amino acids 2 to 449 (448 residues), 727.4 bits, see alignment E=3.5e-223 PF08245: Mur_ligase_M" amino acids 108 to 293 (186 residues), 69.8 bits, see alignment E=4.9e-23 PF02875: Mur_ligase_C" amino acids 315 to 437 (123 residues), 58.8 bits, see alignment E=1.5e-19

Best Hits

Swiss-Prot: 62% identical to MPL_ECOLI: UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (mpl) from Escherichia coli (strain K12)

KEGG orthology group: K02558, UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC: 6.3.2.-] (inferred from 100% identity to saz:Sama_0769)

MetaCyc: 63% identical to UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (Pseudomonas aeruginosa PAO1)
RXN0-2361 [EC: 6.3.2.45]

Predicted SEED Role

"UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-)" (EC 6.3.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.2.- or 6.3.2.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3M0 at UniProt or InterPro

Protein Sequence (458 amino acids)

>Sama_0769 UDP-N-acetylmuramate (RefSeq) (Shewanella amazonensis SB2B)
MHVHILGICGTFMGGLALLARAMGHKVTGSDANVYPPMSTQLEEQGIELIQGFDPVQLES
EPDLVVIGNAMSRGNPCVEAVLNKGMAYTSGPQFLRDHILPGRWVLAVAGTHGKTSTSSM
LAWVLEHCGYEPGFLIGGVPQNFGVSARLGNSPFFVVEADEYDSAFFDKRSKFVHYQPKT
LVINNLEFDHADIFDSLADIQRQFSHVIRTVPGCGKVIWPKGSKAVAEVIEKGLWSEQET
FSHQADADWSVRPLAADGHKFEVLFGGEVQGVLDWQLIGNHNMENAVMAIAAARHVGVAP
AAAIEALSGFMPPKRRLELIGEVGGVSLYDDFAHHPTAIETTLKGLRAKVGNARIFVVLE
PRSNTMKRGVHKDTLALSMALADEAFLYQADNIGWDIRDAMAQAPLPVDVDYDIDSIVAK
VTAKVQRGDQLVVMSNGGFGGIHGKLKAAIAARFAESV