Protein Info for Sama_0761 in Shewanella amazonensis SB2B

Annotation: iron-compound ABC transporter, permease protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 76 to 94 (19 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 256 to 282 (27 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details PF01032: FecCD" amino acids 27 to 341 (315 residues), 272.6 bits, see alignment E=1.9e-85

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to saz:Sama_0761)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3L2 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Sama_0761 iron-compound ABC transporter, permease protein (RefSeq) (Shewanella amazonensis SB2B)
MTALKAMLTPLGRRELMVLALILACLLSPVLASIFGAVDISFREAMSVYLHSLIGERPTD
VAYLDSRILLELRLPRILLAFVCGAGLALSGWALQLVTRNPLADPYLFGISAGASLGAIV
VLSLGITHGVLLAIGLPLGAFIGASASVLVVLTLSGFGLQSQVERMLLSGVATSFLFGAL
GSLLLYFSSPQVTASVIFWSLGSFARAAWDLLWLPWLVFGGFVAFLLLVRRQLFALSAGD
ETAHALGVSVAKLRIISLLMCSLMTAVLVASCGGIGFVGLMIPHIARLLFPGSQSLLIVA
MLGGLFMVWVDVMTRSLLPPQELPVGVITAVVGSVFFLMLLFGRRSE