Protein Info for Sama_0760 in Shewanella amazonensis SB2B

Annotation: iron-compound ABC transporter, ATP-binding protein, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00005: ABC_tran" amino acids 20 to 169 (150 residues), 115.4 bits, see alignment E=3.2e-37 PF13304: AAA_21" amino acids 131 to 198 (68 residues), 28.5 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 38% identical to HMUV_STRCO: Hemin import ATP-binding protein HmuV (hmuV) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to saz:Sama_0760)

Predicted SEED Role

"Iron(III) dicitrate transport ATP-binding protein FecE (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3L1 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Sama_0760 iron-compound ABC transporter, ATP-binding protein, putative (RefSeq) (Shewanella amazonensis SB2B)
MTPAIEVSNLCWRVAERPLLDGVSFALSGNGMYGVIGPNGAGKSSLLRCLYRFIRPDSGT
ILLNGQDIHLYSRRSFARAVAVVPQELPALFDLSTEAVVAMGLIPHKGWLAADSAADKVN
IAAALAEVGLEGYGRQPFGKLSGGEKQRALIARALVQKPQFLILDEPTSHLDVRFQIEVL
ELLKRLDICVICTIHDLNLASALCDELLLMSRGRLEASGSPAEVLTETMLASVFGVCTTV
KPHPQHGRPLIHYYYGYNGRTASQEKEEVSL