Protein Info for Sama_0706 in Shewanella amazonensis SB2B

Annotation: Flp pilus assembly protein CpaB-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR03177: Flp pilus assembly protein CpaB" amino acids 11 to 251 (241 residues), 130.4 bits, see alignment E=3.5e-42 PF08666: SAF" amino acids 51 to 108 (58 residues), 26.1 bits, see alignment E=1e-09 PF16976: RcpC" amino acids 120 to 233 (114 residues), 77 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: K02279, pilus assembly protein CpaB (inferred from 100% identity to saz:Sama_0706)

Predicted SEED Role

"Flp pilus assembly protein RcpC/CpaB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3F8 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Sama_0706 Flp pilus assembly protein CpaB-like protein (RefSeq) (Shewanella amazonensis SB2B)
MQSKRIDFNWVLLGIALVLGSLAAWATKNYFIVKEQEIRAELSNSNVKMVDVVVATQELR
KGDIVDETNMSVRSIRADVIPLDAIRPSQFNEVAGQMLLSEMSPGRPLISAYLPGFKTRQ
FSDLLQEGQRAVTIDINEENSTAGMLVPSDLVDLFLSYTVENGDSERVKMELLIEKAQVL
ATGKRSIDVHPELVNSIYDNPDSYNTVTLALSTEDAIRVSLAKGRGKFVTLLRNKAESAP
VAVTNMFGDQIFGMSGDKGSHQVEYITGGGGLKSSFQEYPLPKELMDELAQGKVNTAL