Protein Info for Sama_0692 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 60 to 82 (23 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details PF05982: Sbt_1" amino acids 5 to 308 (304 residues), 357.8 bits, see alignment E=2.6e-111

Best Hits

KEGG orthology group: K07086, (no description) (inferred from 100% identity to saz:Sama_0692)

Predicted SEED Role

"putative sodium-dependent bicarbonate transporter" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3E4 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Sama_0692 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MPDIVIAFFALGLLAGVIKSDLKVPQSIYETLSILLMLTLGLKGGMSLHGQTDHLQPMEL
LTVVGLGFIIPLALFPILRLLVRLTTSDAASIAAHYGSVSAGTFAVVMAMAETAGWELRP
ETTLYLVMLELPAIVIMLWLHRRLSKGEQTQSGGNILHEALTSRGVVLLLGGVIIGWLYG
PQGLEPLAPMLLSGFKTLLALFLLEMGLVTAKVCIPLPLKQWRLLAFAAIAPFVLAWVGI
GAGITMGLPAGTVLVLAGLTASASYIAAPAAIRAAIPDANIGLAMLASLGITFPVNVLIG
LPLYQHWIAGLMQ