Protein Info for Sama_0680 in Shewanella amazonensis SB2B

Annotation: XRE family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 PF12844: HTH_19" amino acids 15 to 84 (70 residues), 30.6 bits, see alignment E=5.8e-11 PF01381: HTH_3" amino acids 18 to 79 (62 residues), 33.7 bits, see alignment E=6e-12 PF12268: DUF3612" amino acids 326 to 500 (175 residues), 355.5 bits, see alignment E=1.3e-110

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0680)

Predicted SEED Role

"Predicted transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3D2 at UniProt or InterPro

Protein Sequence (504 amino acids)

>Sama_0680 XRE family transcriptional regulator (RefSeq) (Shewanella amazonensis SB2B)
MTSEKSLMRQSHFLGTKIRNLRKRNHLTMEDLSSRCVRVDPGSAPSVSYLSMIERGKRVP
SAAMLEVIAKVFEKSPDWFLDDAPEEDAITPDKGRRGGISGMALEPGFLFSKDILQIAIP
EMLSQTGISGRQFAHLLIRAHQEHHQNHFPDLERAAEEVGDKRLNLSGDDLTAICKQMGM
KIRFFKEPPQDQVDANGVSTHQLVTSFFEPPSTIFINEALKKNPERLKYDLAVHIGHCVL
HNKDGLKNVLAVGRGIGTGEQDADISSTVNAQDILSAWRDFESSFFAGALLCPKVPFRQL
LERGGYEIDTHKKIGVSASVAMRRMTVVSPYPHWHYFDAYAPGKLKAVYRGNGIPLPWGN
MRQVPDPCQHWAVFRMISEPSDGSSAQISILDVGGSPRIYCCESTKVVDLAGNHHVLCAG
IDLNPAIDAQGTDALSLAEALKSHCVASGGQGEIPTAIKRQLMSIARILNINWVERGIDK
GARLICSRGNVCPRKPSCYGGCKG