Protein Info for Sama_0666 in Shewanella amazonensis SB2B

Annotation: iron(III) ABC transporter, periplasmic iron(III)-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13531: SBP_bac_11" amino acids 25 to 282 (258 residues), 48.7 bits, see alignment E=1.7e-16 PF01547: SBP_bac_1" amino acids 33 to 279 (247 residues), 56.2 bits, see alignment E=1.1e-18 PF13416: SBP_bac_8" amino acids 40 to 309 (270 residues), 59.5 bits, see alignment E=9.5e-20 PF13343: SBP_bac_6" amino acids 74 to 296 (223 residues), 69.4 bits, see alignment E=7e-23

Best Hits

Swiss-Prot: 44% identical to FUTA1_SYNY3: Iron uptake protein A1 (futA1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to saz:Sama_0666)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3B8 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Sama_0666 iron(III) ABC transporter, periplasmic iron(III)-binding protein (RefSeq) (Shewanella amazonensis SB2B)
MKLSKGVLLAGLACLTGSAMAADTLTVYSYRQAFLIEPILAEFTKETGIQTQLVFAKDGI
AERLQREGRLSPADLVLTSEFSKLMELVDKDLVDKVQSPVLESNIPAQLRSVDGDWYALT
VRTRSLYSSKERLGKLDIDYEDLADPKYKGKICTRSGKHPYNISLVASMIANKGEAETKV
WLEGLKANLARKPQGNDRAQVKAVKEGLCDIAIGNSYYFGAMMQDPEQKSWAEAVYINFP
NQANRGTHINVSGMAMPKYAPNKEQAVKLMEFLASDKAQHAYAEVNMEYPVKVDVKPSEM
VASWGEFKADTLAIEKLAEYHGAAVKLLDEVKFDL