Protein Info for Sama_0659 in Shewanella amazonensis SB2B

Annotation: ABC transporter, ATP-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 33 to 308 (276 residues), 154.3 bits, see alignment E=5.6e-49 PF00005: ABC_tran" amino acids 369 to 518 (150 residues), 114.5 bits, see alignment E=6e-37

Best Hits

Swiss-Prot: 48% identical to ATM1_CHAGB: Iron-sulfur clusters transporter ATM1, mitochondrial (ATM1) from Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to saz:Sama_0659)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3B1 at UniProt or InterPro

Protein Sequence (594 amino acids)

>Sama_0659 ABC transporter, ATP-binding protein (RefSeq) (Shewanella amazonensis SB2B)
MRPTAYFEGPIEKLNWKVLGLLWPYLLEFKGRILLALLCLLIAKLASVGMPFLLKGLVDD
LDAGRSEALVAVPLGLVLAYGGTRLLMSITGEIRDTLFGRVTERAIRRLGLAVFDHLHRL
DLDFHLERRTGGLSRDIERGTSGVSFLMRFMVFNIVPTLLEIALVVGIFFVKYGWQFAGI
TLVSVILYIGFSVVATEWRTEYVRQAAKADSVSNTRAIDSLLNYETVKYFNNERFESAHY
DKALEAWETAKRNNRLSLFALNGGQALIIAIAMTAMMALAAKHVTESQMTLGDFVLINAF
MMQLFMPLNFLGFVYREIRGALANIERMFGLLDKTPRIEDKTDAVNFACQRGEIRFEQVN
FSYDERTILSDVSFTVAPGEKVAVVGDSGAGKSTLIKLLFRFYDVDSGRICIDDMDLRDM
TQDSLRRAIAIVPQDTVLFNDSLLENIRYGRPDASDEEVRAVVRHAHLADFVAALPSGWD
TKVGERGLKLSGGEKQRVAIARAMLKGSPILVFDEATSSLDSRAEKAILDALKEVATGHT
SLVVAHRLSTIVDADRILVLSKGRIAEQGTHKQLLAMDGLYARLWHIQHEQKMK