Protein Info for Sama_0642 in Shewanella amazonensis SB2B

Annotation: FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01346: FKBP_N" amino acids 40 to 146 (107 residues), 79.2 bits, see alignment E=3.5e-26 PF00254: FKBP_C" amino acids 154 to 240 (87 residues), 104.3 bits, see alignment E=3.4e-34

Best Hits

Swiss-Prot: 49% identical to FKBA_AERHY: FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (fkpA) from Aeromonas hydrophila

KEGG orthology group: K03772, FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [EC: 5.2.1.8] (inferred from 100% identity to saz:Sama_0642)

MetaCyc: 43% identical to peptidyl-prolyl cis-trans isomerase/OMP chaperone FkpA (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FkpA precursor (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S394 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Sama_0642 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (RefSeq) (Shewanella amazonensis SB2B)
MKSIYKYSLVALAVVGLTACNKEEKAAEVAPAVSLTTEAQKEAYSVGASIGSYMSGHIKE
QEALGLPADRALIVEGFANGLNGSLKLTEEEMQTVLQNLDKKLNDKRVAQAEAMAAKNLE
DGKKYQETNKAKEGVTTTESGLQYEVLVAGEGDKPAAEDVVEVHYAGTLIDGTPFDSSYD
RGQTAKFPLNRVIAGWTEGVQLMSVGSKYRFVIPAELAYGERDNGTIPANSTLVFEVELV
SIEKAAAAEAAPAQ