Protein Info for Sama_0637 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR02722: uncharacterized lipoprotein" amino acids 9 to 192 (184 residues), 250.9 bits, see alignment E=4.6e-79 PF13036: LpoB" amino acids 46 to 190 (145 residues), 195.8 bits, see alignment E=1.7e-62

Best Hits

KEGG orthology group: K07337, hypothetical protein (inferred from 100% identity to saz:Sama_0637)

Predicted SEED Role

"Lipoprotein YcfM, part of a salvage pathway of unknown substrate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S389 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Sama_0637 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MELTMKHFKLIFILAASLGLGACQSRVEYGDATEVETVNENFGSTDLQAITAKMVDSMLT
FPPVVAMTAKQRPIIFVDKIKNKTSEHIDTESVTDSISNKLLRSGKFRFIDMTKVDAVRK
QLDYQNNSGMVDPSTAIRFGRQIGAQYMLYGNLSSIVKQEGSTKDVYYKMTMRLMDLETG
LIEWSDEKEIRKTKSKSFLGM