Protein Info for Sama_0584 in Shewanella amazonensis SB2B

Annotation: elongation factor G (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 TIGR00484: translation elongation factor G" amino acids 2 to 689 (688 residues), 990.4 bits, see alignment E=4.2e-302 TIGR00231: small GTP-binding protein domain" amino acids 6 to 176 (171 residues), 93 bits, see alignment E=1.8e-30 PF00009: GTP_EFTU" amino acids 6 to 278 (273 residues), 198.5 bits, see alignment E=2.1e-62 PF03144: GTP_EFTU_D2" amino acids 321 to 388 (68 residues), 71.2 bits, see alignment E=2e-23 PF14492: EFG_III" amino acids 401 to 474 (74 residues), 100.1 bits, see alignment E=1.4e-32 PF03764: EFG_IV" amino acids 476 to 595 (120 residues), 151.7 bits, see alignment E=2e-48 PF00679: EFG_C" amino acids 597 to 683 (87 residues), 96.6 bits, see alignment E=1.8e-31

Best Hits

Swiss-Prot: 88% identical to EFG2_VIBCH: Elongation factor G 2 (fusA2) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02355, elongation factor G (inferred from 86% identity to mme:Marme_2319)

Predicted SEED Role

"Translation elongation factor G paralog" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S336 at UniProt or InterPro

Protein Sequence (696 amino acids)

>Sama_0584 elongation factor G (RefSeq) (Shewanella amazonensis SB2B)
MTDLSKYRNIGIFAHVDAGKTTTTERILKLTGKIHKLGEVHDGASTMDFMDQEAERGITI
QSAATTCFWKGHRFNVIDTPGHVDFTVEVYRSLKVLDGGIGVFCGSGGVEPQSETNWRYA
NESEVARLIFVNKLDRIGADFLRVVGQVKKVLAANPLVMTLPIGREDEFTGVVDVLNRQA
FIWDDSGLPENYTVTDVPADMVDLVEEYREMLVETAVEQDDDLMEAYMEGEEPSIEDLKR
CIRKGTINLSFFPTFCGSAFKNKGMQLVLDAVVDYLPSPTEVEPQPLTDPETGEETGKVA
TVSVDEPLRALAFKIMDDRFGALTFVRIYSGKLKKGDTILNSATGKTERIGRMVEMHAND
RNEIDSAQAGDIIAVVGMKNVQTGHTLCDPKHECTLEPMIFPTPVISIAVTPKDKGASEK
LGVALGKMVAEDPSFQVETDQETGDTILKGMGELHLDIKVDILKRTFGVELTVGAPQVAY
RETITAAIEDSYTHKKQSGGSGQYGKIDYRIRPGEPGTGFTFKSAVVGGNVPREFWPAVE
SGFEEMMSQGPLAGFPVLDVEVELFDGAYHAVDSSAIAFEIAAKGAFRQSMPKAKPQLLE
PIMKVDVFTPDDHVGDVIGDLNRRRGMIKDQEAGLTGVRVKADVPLAEMFGYIGHLRTMT
SGRGQFSMEFSHYNPCPANVAETVIAETKAKNAAKK