Protein Info for Sama_0547 in Shewanella amazonensis SB2B

Annotation: sensor histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details PF17149: CHASE5" amino acids 40 to 144 (105 residues), 116.3 bits, see alignment E=6.1e-38 PF02518: HATPase_c" amino acids 420 to 528 (109 residues), 64 bits, see alignment E=1.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0547)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S301 at UniProt or InterPro

Protein Sequence (547 amino acids)

>Sama_0547 sensor histidine kinase (RefSeq) (Shewanella amazonensis SB2B)
MLGFSRQAVSSKIGRRLMISIVLFSSLITLITTGYQLFNDYNGDLNRIDRAFSNIEKVNL
DVLAASIWVIDERLINTQLEGLIQLPDITYISIDDDSGQHWSRGAPIDKNFIEKVFSLNY
NSGSESISVGKLTILADLNAVYERIYDKAIIILLSNAIKTFLVAGMILILVWLNITRHLN
TLAAYCQDISVEHEYQPLTFQKRGAQNEFDQVALAINEMQEQLHRSFGALKKSKSDLQHA
LEDRERLLELERSYKEELAKQVKERTMELEQSLLILKRAQEALVEQEKMAALGGLVSGVA
HEINTPIGICLTAASTQLAHIDELISLIHSEEATLEEINAILEEYQQSCELIVSNITRAS
NLIQKFKTIAAENSHEAHEQIPIAQLCRDIHDSTQLIYAPTMANMELDIADELQVETNYS
LLNQILSNLMSNIYAHAFAQGRENLFRVEAYLENRRLVVRLEDNGPGIAADVAEHMFEPF
YTTIRARGGTGLGLSAAFNAATLLKGSVRYEGKSTLGGACFVLSIPVKRDDDLQASDSVK
DGYQFHI