Protein Info for Sama_0536 in Shewanella amazonensis SB2B

Annotation: galactokinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR00131: galactokinase" amino acids 7 to 379 (373 residues), 301.4 bits, see alignment E=4.5e-94 PF10509: GalKase_gal_bdg" amino acids 11 to 59 (49 residues), 81.5 bits, see alignment 3.8e-27 PF00288: GHMP_kinases_N" amino acids 115 to 181 (67 residues), 46.5 bits, see alignment E=6.2e-16

Best Hits

Swiss-Prot: 45% identical to GAL1_ALIF1: Galactokinase (galK) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: K00849, galactokinase [EC: 2.7.1.6] (inferred from 100% identity to saz:Sama_0536)

Predicted SEED Role

"Galactokinase (EC 2.7.1.6)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2Z0 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Sama_0536 galactokinase (RefSeq) (Shewanella amazonensis SB2B)
MSNPAQRATKLFVQTFGTKADAYYQAPGRVNIIGEHTDYNDGFVLPAAINFHTVIAVKKR
EDDRFRVVTEAFPGELREWRFGEEGEVTAGGDWVNYLKGFTQAVGQAGLKAKGLDLAVVS
SIPMGAGFSSSGALEIAFGTALNDTCQLHLSPMAIAQLAQRGESRFHGSTCGVMDHMTSA
LAEADSALLIDCLDLDIEAVLIPDNLSLIIVHSPLDPKLLEEAYKARADECRDAAEFFGL
DSLRDLELDELKAASDVLDETLYKRARHVISENLRTQSAGRALKRGDVARLSELMALSHA
SLRDDFELMVPEVETLVQIMAQAIGDRGGVRMTDGCSVVALVEHDLTDAVVHAVESEYPA
KTGLEPVLYMCAPSAGAGRIDG