Protein Info for Sama_0517 in Shewanella amazonensis SB2B

Annotation: D-beta-hydroxybutyrate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00106: adh_short" amino acids 11 to 202 (192 residues), 183.8 bits, see alignment E=4e-58 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 11 to 266 (256 residues), 314.9 bits, see alignment E=1.7e-98 PF08659: KR" amino acids 14 to 166 (153 residues), 34 bits, see alignment E=4.4e-12 PF13561: adh_short_C2" amino acids 19 to 264 (246 residues), 195.5 bits, see alignment E=1.7e-61

Best Hits

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 100% identity to saz:Sama_0517)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2X1 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Sama_0517 D-beta-hydroxybutyrate dehydrogenase (RefSeq) (Shewanella amazonensis SB2B)
MSGGQRSLEGKVGLITGSTSGIGLATAQVLAEQGCNLILHGLLPEDEGQSMAADFAAQYR
IRTFFSNADLRQPESIHRFMAEGTKALGSIDILINNAGIQHTDSVASFPIEKWNDIIAIN
LSSAFHTMQQAVPAMAQKRWGRIINIASVHGLVASVNKAAYCAAKHGIVGLTKVVAIECA
EQGITVNAICPGWVDTPLINKQIEAVANTKGLDYHEARYQLVTAKQPLPEMLDPRQIGEF
ALFLCGDAARGITGASLAMDGGWTAQ