Protein Info for Sama_0510 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 200 to 225 (26 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 3 to 309 (307 residues), 398.8 bits, see alignment E=9e-124 PF03741: TerC" amino acids 77 to 278 (202 residues), 180.3 bits, see alignment E=1.6e-57

Best Hits

Swiss-Prot: 60% identical to ALX_SALTI: Putative membrane-bound redox modulator Alx (alx) from Salmonella typhi

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 100% identity to saz:Sama_0510)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2W4 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Sama_0510 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
METWWLWAAFAAIVLTLLWVDIKFVGGKSHKVSMKEALTWSLVWFVVAMAFNAGVWAWLD
YSVGREIANDKALEFLTAYVIEKALAVDNVFVWLMIFSYFAIPPELQRRVLLYGVLGAIV
MRAGMVFGGIWLINQFHWLLYVFGAFLVFTGVKMLLTADKETDLSTHRGLIWLRSKMKLT
EHLEGERFFVLREGVKYATPLFLVLILVEISDLIFAVDSIPAIFAVTTDPFIVLTSNIFA
IMGLRAMYFLLQGAAEKFSLLKYGLAIILVFIGFKLMLIDVFHLPIAVALGVVGTILVGS
MLLSLWVNRNKPTRFE