Protein Info for Sama_0493 in Shewanella amazonensis SB2B

Annotation: transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 PF12840: HTH_20" amino acids 16 to 65 (50 residues), 37.2 bits, see alignment E=3.5e-13 PF13412: HTH_24" amino acids 18 to 63 (46 residues), 24.3 bits, see alignment E=2.9e-09 PF01022: HTH_5" amino acids 18 to 64 (47 residues), 58.8 bits, see alignment E=6e-20

Best Hits

Swiss-Prot: 55% identical to ARSR2_PSEPK: Arsenic resistance transcriptional regulator ArsR2 (arsR2) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 100% identity to saz:Sama_0493)

Predicted SEED Role

"Arsenical resistance operon repressor" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2U7 at UniProt or InterPro

Protein Sequence (117 amino acids)

>Sama_0493 transcriptional regulator (RefSeq) (Shewanella amazonensis SB2B)
MPEEAAMDVVSFFKALADDTRLRILMLIVGETELCVCELTEALNLSQPKISRHLRLLKDA
GLLTDRRQGQWVYYRQAEDLPLWCAGQLAHLAQKGPDWLADEKQRLTTMGCRPGRCC