Protein Info for Sama_0492 in Shewanella amazonensis SB2B

Annotation: sodium/proline symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 308 to 334 (27 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details amino acids 392 to 417 (26 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details amino acids 454 to 475 (22 residues), see Phobius details TIGR02121: sodium/proline symporter" amino acids 6 to 492 (487 residues), 661.5 bits, see alignment E=7.9e-203 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 34 to 432 (399 residues), 303.2 bits, see alignment E=3.2e-94 PF00474: SSF" amino acids 34 to 432 (399 residues), 326 bits, see alignment E=1.7e-101

Best Hits

Swiss-Prot: 54% identical to PUTP_BACSU: High-affinity proline transporter PutP (putP) from Bacillus subtilis (strain 168)

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 100% identity to saz:Sama_0492)

Predicted SEED Role

"Proline/sodium symporter PutP (TC 2.A.21.2.1) @ Propionate/sodium symporter" (TC 2.A.21.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2U6 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Sama_0492 sodium/proline symporter (RefSeq) (Shewanella amazonensis SB2B)
MEYSSYISLALYFIAMLAIGLFAYRNSTDDLAGYMLGGRQVSPHVTALSAGASDMSGWML
MGLPGAMFTMGYDALWIAAGLLLGALLNYLLVAPRLRVFTEAADDALTLPDFFSKRFNKD
NGSVRMISAAVIILFFTLYTSAGLVAGGKFFESAFGLGYQTGLLLTVSVVVAYTLLGGFL
AVSLTDFVQGCIMFLALVLVPLVALQEFNSSTDMLAQASRSITPLADSFEHMGILAIVSS
LAWGLGYFGQPHIIVRFMAIRSVKDIAVARNIGMSWMLVTILGALATGLIGVAYVNKFKP
GLDDGETIFILFAEILFHPLISGFLLAAILAAIMSTISSQLLVSSSSLSEDVYRALFHKE
MDQKATVTAGRIGVLAVAAVATLLALDNNASILSLVSNAWAGFGAAFGPLVLLSLFWPRM
THSGAVAGILCGAGTVLVWSQVPLLENGLPLSSLIYEIVPGFIVSTLAIVLVSYADQAPC
KSTQKAFKLSRDRLKQVS