Protein Info for Sama_0487 in Shewanella amazonensis SB2B

Annotation: N-acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 25 to 137 (113 residues), 70.6 bits, E=4.9e-23
• PF13302: Acetyltransf_3
  • amino acids 31 to 138 (108 residues), 45.7 bits, E=3.9e-15
• PF13673: Acetyltransf_10
  • amino acids 53 to 144 (92 residues), 35.5 bits, E=3.2e-12
• PF13420: Acetyltransf_4
  • amino acids 54 to 155 (102 residues), 52.2 bits, E=2.5e-17
• PF13508: Acetyltransf_7
  • amino acids 58 to 138 (81 residues), 43.1 bits, E=1.6e-14
• PF12746: GNAT_acetyltran
  • amino acids 83 to 141 (59 residues), 28.9 bits, E=3.1e-10
• PF08445: FR47
  • amino acids 85 to 140 (56 residues), 35.3 bits, E=3.3e-12

Best Hits

Swiss-Prot: 51% identical to MDDA_PSEA7: L-methionine sulfoximine/L-methionine sulfone acetyltransferase (PSPA7_5587) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to saz:Sama_0487)

MetaCyc: 47% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"Phosphinothricin N-acetyltransferase (EC 2.3.1.-)" (EC 2.3.1.-)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• phosalacine biosynthesis (2/25 steps found)
• phosphinothricin tripeptide biosynthesis (2/25 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Arginine and proline metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.1, 2.3.1.183

Use Curated BLAST to search for 2.3.1.- or 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

See A1S2U1 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Sama_0487 N-acetyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MHIASCQFEQHGAIIQHIFNHAIANTTALYEYEPRDMARIAAWFAQKEGLYPVLGAFDEK
GDLMGFASYGPFRGFPANLYSVEHSVYVHSDHRGKGVALKLMQALIQAAKDAGLHMMVGG
IDASNNASIALHKKLGFEHAGTLKEVGYKFNRWLDLAFYQLKLSE