Protein Info for Sama_0480 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 227 to 252 (26 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 321 to 336 (16 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 21 to 368 (348 residues), 158.8 bits, see alignment E=2.1e-50 PF01061: ABC2_membrane" amino acids 221 to 335 (115 residues), 31 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to saz:Sama_0480)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2T4 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Sama_0480 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MTLLRLILEELKAIVADKAIAVTLFGGVLFYALLYPLPYLNQVPTEQALVVVDLDNTSLS
RELIRHADASPKIRVARAAGSVAEAQHYIASGDFHGLLVIPAGFKRDLLLGKGATLSYGG
DASYFLVYSALVEGLVTAGMDAARSVQLLGMLSRGESFAGASLSLLPMHLNAVPAYNPGL
GYTPYVVPGLFLLILHQTLLIGTGILGAGQWRKAGYWQQVSSLELLIGRIAAFGLIYAAL
GAFYMGWCYHWYGVSVQAGLGDIAAFIVPFYLATAAAGVAASCLFRRRDMPTQVMLLASM
PILFVSGFVWPLSLIPEPLVMAAQTIPAVPAIFGMLKLNQLGTGFDGVFSEWLTLWLLAL
VYLALAWWGLVVRQREVNQLSPPKQG