Protein Info for Sama_0368 in Shewanella amazonensis SB2B

Annotation: type IV pilus biogenesis protein PilC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 87 to 105 (19 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 236 to 253 (18 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details PF00482: T2SSF" amino acids 85 to 207 (123 residues), 114.9 bits, see alignment E=1.2e-37 amino acids 288 to 410 (123 residues), 107.5 bits, see alignment E=2.3e-35

Best Hits

Swiss-Prot: 63% identical to TAPC_AERHY: Type IV pilus assembly protein TapC (tapC) from Aeromonas hydrophila

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 100% identity to saz:Sama_0368)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2H3 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Sama_0368 type IV pilus biogenesis protein PilC (RefSeq) (Shewanella amazonensis SB2B)
MATAVANKSKKQTQKLAPKVYNFEWKGLNRDGKKSSGELRGASVAEIKTLLKNQGINPKV
VRKKSDGLFGASNKKINAMDIAMVTRQIATMLMAGVPLVTTIEILGKGHEKPKMRELLGT
ILNDIQAGIPLSDALRPHRIYFDDLYVDLVAAGEHSGSLDTVFDRIATYREKAEALKSKI
KKAMFYPAAVVVVAIAVTTLLLLFVVPQFEEIFTSFGAELPAFTQLIINISRFLQSSWYF
FLTAIVGSIWLYVRAHRNSQAVRDRQDEFVLKIPVIGEILHKAAMARFARTLATTFAAGV
PLIDGLESAAGASGNAVYRKALLRIRTEVMAGMQMNVAMRTVNLFPDMLIQMVMIGEESG
SLDNMLNKIANIYEMQVDDAVDGLSSLIEPIMMVVIGTLVGGLIVGMYLPIFQMGNVVG