Protein Info for Sama_0349 in Shewanella amazonensis SB2B

Name: murE
Annotation: UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 PF01225: Mur_ligase" amino acids 21 to 99 (79 residues), 34.7 bits, see alignment E=2.8e-12 TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 25 to 480 (456 residues), 492.9 bits, see alignment E=5.5e-152 PF08245: Mur_ligase_M" amino acids 111 to 310 (200 residues), 167 bits, see alignment E=7.9e-53 PF02875: Mur_ligase_C" amino acids 333 to 459 (127 residues), 121 bits, see alignment E=8.7e-39

Best Hits

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 100% identity to saz:Sama_0349)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2F4 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Sama_0349 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase (RefSeq) (Shewanella amazonensis SB2B)
MMLLKDLLAPWFHYAGTESVHAPVIDSRQLTAGGLFIAVPGYKTDGRAYLDAAFAKGAAA
ALVHTDDPDEHGKVSYEPGLCIAFFQLNRQVSAVARQYYALTRGKLRVVGVTGTNGKTSV
SQLIAQLTELLGDKAAVMGTLGNGLWGQLQDVGNTTADAVRVMADLYDFEHQGAKVCAME
VSSHGLVQGRVEAVPFEVAVFTNLSRDHLDYHGDMDNYAAAKRRLFAFGSLSARVINLDD
KVGEQWFDGMGCATGFSCLGHAKADWRFENAHFHHAGFSANLVWPGGQKPLECRLLGAFN
LSNLLAALCAMAQLGYQVPDLVAAAAKLEAVPGRMECFPRKDGVSLVVDYAHTPDAIEQA
LKAARHHCEGALWIVFGCGGDRDKGKRPLMAEAAEAFADCLVLTSDNARSEDPAVILEDM
KAGLDAPERALCMVDRVAAIRHAVSMAKPGDLILLAGKGHETYQEIAGVKHEYDERALAR
VLSEENL