Protein Info for Sama_0327 in Shewanella amazonensis SB2B

Name: radC
Annotation: DNA repair protein RadC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF20582: UPF0758_N" amino acids 3 to 80 (78 residues), 97.9 bits, see alignment E=4.3e-32 TIGR00608: DNA repair protein RadC" amino acids 12 to 224 (213 residues), 228.9 bits, see alignment E=3e-72 PF04002: RadC" amino acids 104 to 223 (120 residues), 144.5 bits, see alignment E=2.2e-46

Best Hits

Swiss-Prot: 100% identical to Y327_SHEAM: UPF0758 protein Sama_0327 (Sama_0327) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 100% identity to saz:Sama_0327)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2D2 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Sama_0327 DNA repair protein RadC (RefSeq) (Shewanella amazonensis SB2B)
MAIRDWPEGEGPREKLLQRGAAHLSDAELLAVLLRNGVSGQNAVDLARELIGEFGGLRPL
FSATKQQVCRLQGLGPVKYAQLQASAELARRLAGESLQRGAVLTSPDLTRDYLRFQLADR
AYEVFAVLLLDSQHRVIQFVELFRGTIDAASVYPRELVSLVLEKRAAAVIVCHNHPSGVA
EPSQADRRITERLKNALATIDVSLLDHMVVGDREIVSFAERGWIG