Protein Info for Sama_0292 in Shewanella amazonensis SB2B

Annotation: glucose/galactose transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details amino acids 25 to 25 (1 residues), see Phobius details transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 270 to 287 (18 residues), see Phobius details amino acids 293 to 317 (25 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details PF07690: MFS_1" amino acids 4 to 325 (322 residues), 80.4 bits, see alignment E=6.1e-27 TIGR01272: glucose/galactose transporter WARNING" amino acids 78 to 371 (294 residues), 360.4 bits, see alignment E=4.9e-112

Best Hits

Swiss-Prot: 60% identical to GLUP_BRUAB: Glucose/galactose transporter (gluP) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 100% identity to saz:Sama_0292)

Predicted SEED Role

"Predicted mannose transporter, GGP family" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S297 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Sama_0292 glucose/galactose transporter (RefSeq) (Shewanella amazonensis SB2B)
MTTLFFIWGFITALNDILIPHLKAAFELSYTQAMLVQFCFFGAYFIVSPFAGKLIEKIGY
IRGIVTGLCTMATGCLLFYPAAEVSVYALFLLGLFVLASGITILQVSANPYVAILGAERT
AASRLSLAQAINSLGHTLAPLFGAALIFGAASNAHAVQLPYLILAGAVLLTAVGFVFLKL
PTLQTDHETQVSHSDSIWQHKHLVLGALAIFLYVGAEVSVGSFLVNYFSESHIAALSEQE
ASRMVSYYWGGAMVGRFVGSALTRILQPTYVLATNALMAILLLVLTMNSSGALAMWSVLA
VGFFNSIMFPTIFTLAIRGLGPLTSRGSGLLCQAIVGGAILPLLQGVVADSSSVQFSFVI
PMVAYLYIGWYALRGSKACEKAKIVEAQS