Protein Info for Sama_0285 in Shewanella amazonensis SB2B

Annotation: nucleotidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 10 to 195 (186 residues), 85.6 bits, E=8.9e-28
• TIGR02254: noncanonical pyrimidine nucleotidase, YjjG family
  • amino acids 10 to 226 (217 residues), 236.2 bits, E=4.5e-74
• PF13419: HAD_2
  • amino acids 86 to 200 (115 residues), 68.3 bits, E=1.5e-22
• TIGR01509: HAD hydrolase, family IA, variant 3
  • amino acids 101 to 201 (101 residues), 33.3 bits, E=7.7e-12
• TIGR01549: HAD hydrolase, family IA, variant 1
  • amino acids 104 to 195 (92 residues), 61.4 bits, E=2e-20
• PF13242: Hydrolase_like
  • amino acids 155 to 201 (47 residues), 44.1 bits, 2.4e-15

Best Hits

Swiss-Prot: 56% identical to YJJG_ECO57: Pyrimidine 5'-nucleotidase YjjG (yjjG) from Escherichia coli O157:H7

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to saz:Sama_0285)

MetaCyc: 56% identical to pyrimidine 5'-nucleotidase YjjG (Escherichia coli K-12 substr. MG1655)
3.1.3.M8 [EC: 3.1.3.M8]; 5'-nucleotidase. [EC: 3.1.3.M8, 3.1.3.5]

Predicted SEED Role

"5'-nucleotidase YjjG (EC 3.1.3.5)" (EC 3.1.3.5)

MetaCyc Pathways

• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation II (3/5 steps found)
• guanosine nucleotides degradation III (2/4 steps found)
• guanosine nucleotides degradation I (1/4 steps found)
• guanosine nucleotides degradation II (1/4 steps found)
• ureide biosynthesis (3/7 steps found)
• adenosine nucleotides degradation I (3/8 steps found)
• superpathway of guanosine nucleotides degradation (plants) (1/6 steps found)
• purine nucleotides degradation I (plants) (4/12 steps found)
• NAD salvage (plants) (3/11 steps found)
• tunicamycin biosynthesis (1/9 steps found)
• superpathway of purines degradation in plants (4/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.M8

Sequence Analysis Tools

See A1S290 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Sama_0285 nucleotidase (RefSeq) (Shewanella amazonensis SB2B)
MSNCSPLSFDWVLFDADETLFHFDAFAGLKRLFARFEVDFGEAQFHEYQQVNKPLWLEYQ
DGRISAKTLQEQRFALWGERLGVAPGELNSGFLQAMADICAPLPQVPELLESLKGRYRLG
IITNGFTELQRIRLERTGFADHFELLVISEEVGLAKPDKAIFDHALDAMGNPARERVLMV
GDTLSSDIQGGLNAGLHTCWYNPNAKVNEAGILPHLEISCHSELARLLA