Protein Info for Sama_0247 in Shewanella amazonensis SB2B

Annotation: cytochrome c-type biogenesis protein CcmH (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details TIGR03142: cytochrome c-type biogenesis protein CcmI" amino acids 3 to 123 (121 residues), 94.7 bits, see alignment E=2.3e-31 PF14559: TPR_19" amino acids 150 to 191 (42 residues), 26 bits, see alignment 3.9e-09 PF23914: TPR_CcmH_CycH" amino acids 152 to 264 (113 residues), 56.8 bits, see alignment E=1e-18 PF13431: TPR_17" amino acids 153 to 183 (31 residues), 23 bits, see alignment (E = 2.6e-08) PF13181: TPR_8" amino acids 164 to 190 (27 residues), 22.4 bits, see alignment (E = 3.8e-08) PF07719: TPR_2" amino acids 164 to 192 (29 residues), 24.9 bits, see alignment (E = 6e-09) PF23892: Ig_CycH" amino acids 307 to 413 (107 residues), 112.2 bits, see alignment E=4.1e-36

Best Hits

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 100% identity to saz:Sama_0247)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmH" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S252 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Sama_0247 cytochrome c-type biogenesis protein CcmH (RefSeq) (Shewanella amazonensis SB2B)
MTTFWILIAFVVLIGLMLIWVPHFRQQRLLEAEEAGVRKQTNLELFNERLAILEKELAED
LLDNQEFEALKKELEISLLQDIKQGSDESLVNTVKPKGLLWPVVMSVTLLGISGYMYQHL
GQYENVANPPRAANPHEGMTAEQIMSQRVQMMEMAVQAEPDNSQAWFNLGHAYISANRFD
EAVNAFDKVMALVGTHAELLGPKATALYYKNNQQMSAEIQALVDQSLALDPQDPSTLLLV
GMDSFFTANYQKAIDAWQSILSTQRTDIDRTALMNAIETARMKMAAESGEMPQDSVHQPV
AKAVPTVTVQISVSPELAANVSDSDMLFIFARATEGPKVPLAATKISAKALPATITLDDS
TNMGGDVKLSSAKQVEIIAVLSKHGSVKPQSGDLKGSLNGVDVGGESVNLVLDTLVQ