Protein Info for Sama_0245 in Shewanella amazonensis SB2B

Annotation: cytochrome c biogenesis protein CcmA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 13 to 211 (199 residues), 239.2 bits, see alignment E=1.5e-75 PF00005: ABC_tran" amino acids 28 to 166 (139 residues), 96.5 bits, see alignment E=2.2e-31

Best Hits

Swiss-Prot: 85% identical to CCMA_SHESM: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Shewanella sp. (strain MR-4)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 100% identity to saz:Sama_0245)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S250 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Sama_0245 cytochrome c biogenesis protein CcmA (RefSeq) (Shewanella amazonensis SB2B)
MTLPTKTAHSLVSAEKLTCIREERILFDELSFSVNEGDIIQIEGPNGAGKTSLLRILAGL
SRPYAGSVFYRDEEIGRCRDEFNEDLLYLGHLAGVKSELTAEENLNFNLRLSGYDDFDTG
EVLAKVNLKGFEEALAGHLSAGQHRRTALARLWHSNCKVWILDEPFTAIDKRGVAELEQL
FLKHADNGGCVILTTHQDMGLIKDERLRKLKLEYRFV