Protein Info for Sama_0220 in Shewanella amazonensis SB2B

Name: rplP
Annotation: 50S ribosomal protein L16 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR01164: ribosomal protein uL16" amino acids 2 to 126 (125 residues), 192.1 bits, see alignment E=1.7e-61 PF00252: Ribosomal_L16" amino acids 4 to 131 (128 residues), 169 bits, see alignment E=2.4e-54

Best Hits

Swiss-Prot: 100% identical to RL16_SHEAM: 50S ribosomal protein L16 (rplP) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K02878, large subunit ribosomal protein L16 (inferred from 100% identity to saz:Sama_0220)

MetaCyc: 90% identical to 50S ribosomal subunit protein L16 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L16p (L10e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S225 at UniProt or InterPro

Protein Sequence (136 amino acids)

>Sama_0220 50S ribosomal protein L16 (RefSeq) (Shewanella amazonensis SB2B)
MLQPKRMKFRKMHKGRNRGLAAGTEVSFGTFGLKAVGRGRLTARQIESARRAMTRHVKRQ
GKIWIRVFPDKPITAKPLEVRMGKGKGNVEYWVCQIQPGKVLYEMDGVSEELAREAFGLA
AAKLPIKTTFVIKTVM