Protein Info for Sama_0184 in Shewanella amazonensis SB2B

Annotation: cysQ protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 119 to 138 (20 residues), see Phobius details PF00459: Inositol_P" amino acids 4 to 247 (244 residues), 170.3 bits, see alignment E=3.1e-54 TIGR01331: 3'(2'),5'-bisphosphate nucleotidase" amino acids 7 to 256 (250 residues), 299 bits, see alignment E=1.5e-93

Best Hits

KEGG orthology group: K03677, CysQ protein (inferred from 100% identity to saz:Sama_0184)

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.7

Use Curated BLAST to search for 3.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1Y9 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Sama_0184 cysQ protein (RefSeq) (Shewanella amazonensis SB2B)
MKPEQLVDEAIAIATQAGNKIREIYLAGDFERIVKSDNTPVTSADLAANQIIMDGLRQLT
PHIPILSEEAADIPLCERVDWPCYWLVDPLDGTGEFIAGSGDFSVIIALVEHNRPVMGVV
YVPMTGVCYYAVAGLGAYKRSGGMEVRITSRQLPSGVEPSLRLAVSRRQDPQSVLKLFHQ
PRHCELVVMGGAALKSCLVAEGRADCYVRVGPTGEWDTGAAQIIIEEAGGQLMDIELQPL
SYNERDTFENPNFVVVGSPNLDWDKILVGE